(data stored in ACNUC7421 zone)

EMBL: CP000251.PE52

CP000251.PE52        Location/Qualifiers
FT   CDS             63293..64207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0052"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79830"
FT                   /db_xref="GOA:Q2IM00"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79830.1"
FT                   /translation="MADLALLVLTLLWGTTFALVKEALEIASPGVFLTARFGLAAVALL
FT                   AAWALRPRAPLGDGFWRHGILLGLTMLVGFVLQTVALRHTTPARSGFITGLNVLVVPVV
FT                   ARWFLGRRVRPAFWVGVAFALAGLVMLTRPFTPGAVTEEVRFGDLLTLFCAVAYGLQVT
FT                   FTSEWAPRHPLAPFVAVQVLVTLAGALVLAPLEGPRFDPAGAGHFALVVAFTGLVMTAL
FT                   AFFVMNWGQRHTTAVRAALIFSLEPAAAAVFSWLYYGEPLGPLDWAGGALMVLGVVAGE
FT                   VGGVLEARAPRRARGERASTGPG"
     MADLALLVLT LLWGTTFALV KEALEIASPG VFLTARFGLA AVALLAAWAL RPRAPLGDGF        60
     WRHGILLGLT MLVGFVLQTV ALRHTTPARS GFITGLNVLV VPVVARWFLG RRVRPAFWVG       120
     VAFALAGLVM LTRPFTPGAV TEEVRFGDLL TLFCAVAYGL QVTFTSEWAP RHPLAPFVAV       180
     QVLVTLAGAL VLAPLEGPRF DPAGAGHFAL VVAFTGLVMT ALAFFVMNWG QRHTTAVRAA       240
     LIFSLEPAAA AVFSWLYYGE PLGPLDWAGG ALMVLGVVAG EVGGVLEARA PRRARGERAS       300
     TGPG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page