(data stored in ACNUC7421 zone)

EMBL: CP000251.PE525

CP000251.PE525       Location/Qualifiers
FT   CDS             618704..619309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0527"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80303"
FT                   /db_xref="GOA:Q2INB8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80303.1"
FT                   /translation="METWIATAGLVAVGVFTPGPSNFVVMHRAAAAGLRGAAPAIAAVL
FT                   LGLVALLGLAAAGGGALLAAAPALGRVLQAGGAVYLAWGGVALVVESFRRGPAEGGAAG
FT                   GALPQRPAAVFLFQFTNPKAWAMVLTAASACGGGGAGAAFLRLVPLFTALSLAGLLTWA
FT                   MLGSALERAMRVPRWRRRIDRAMGALLAASAALLLAGA"
     METWIATAGL VAVGVFTPGP SNFVVMHRAA AAGLRGAAPA IAAVLLGLVA LLGLAAAGGG        60
     ALLAAAPALG RVLQAGGAVY LAWGGVALVV ESFRRGPAEG GAAGGALPQR PAAVFLFQFT       120
     NPKAWAMVLT AASACGGGGA GAAFLRLVPL FTALSLAGLL TWAMLGSALE RAMRVPRWRR       180
     RIDRAMGALL AASAALLLAG A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page