(data stored in ACNUC7421 zone)

EMBL: CP000251.PE528

CP000251.PE528       Location/Qualifiers
FT   CDS             complement(620614..621213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0530"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80306"
FT                   /db_xref="GOA:Q2INC4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80306.1"
FT                   /translation="MLAAITHDLHTAGEAWLFRALNADGGPILDGLMVLVSSKPFGAAW
FT                   AILLAILVARAARGPLAARLRLVAALGAAIAMSDGLGSQLLRPLLARRRPCYALPPGTF
FT                   RWLAPAADVGSLPSLHAANFFAMATVAAAAGPRLGLAALGVAVLVALSRVYVGVHWPTD
FT                   VLAGAVWGVLCGMLARLLATRLWAAWQRRRPAPPAP"
     MLAAITHDLH TAGEAWLFRA LNADGGPILD GLMVLVSSKP FGAAWAILLA ILVARAARGP        60
     LAARLRLVAA LGAAIAMSDG LGSQLLRPLL ARRRPCYALP PGTFRWLAPA ADVGSLPSLH       120
     AANFFAMATV AAAAGPRLGL AALGVAVLVA LSRVYVGVHW PTDVLAGAVW GVLCGMLARL       180
     LATRLWAAWQ RRRPAPPAP                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page