(data stored in ACNUC7421 zone)

EMBL: CP000251.PE529

CP000251.PE529       Location/Qualifiers
FT   CDS             complement(621285..623102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0531"
FT                   /product="suppressor of poH thermosensitive mutation
FT                   transmembrane protein, SuhR"
FT                   /note="similar to suppressor of E.coli rpoH thermosensitive
FT                   mutation transmembrane protein, SuhR"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80307"
FT                   /db_xref="GOA:Q2INC3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80307.1"
FT                   /translation="MQTGTTEAEGLLECDLVMKGGITSGVVYPLALVELARRYRFRSVG
FT                   GSSAGAIAAAAAVAAEYGRQSGATVEGSGFAGLARLPASLGERLPGGGSRLSSLFQPTR
FT                   RTRPVLEALLGAARGRSAAGKAARALAPLVVAAPGCWVALAGLLLAGAVGAVAGRQGGV
FT                   AEAAALWLSAAAVLALAALGAVVASAVSALGAIRDNGLGVCSGFAPPGRGGPPPLTTWL
FT                   HGLVQSLAGTREVLTLGHLERHGLRLEVTTTSVTHQRPFRLPLHPDDPVFFFREAEFRA
FT                   LFPGEVVDRLVEAGRAEEAERRARTDGRRVRLPAHDPSLVLFPRGPGLPVVVLARMSLS
FT                   FPLLLGAVPLYGVDWTRRRNQRRRAEPELERAWFSDGGICSNIPIHFFDAALPTRPTFA
FT                   IDLREQHPDHPLGAWLPANNASGIAQRWRRLGEGRAAPLRFLAAVVATMQTWVDEMQLA
FT                   APGYRDRIVHVSHAADEGGLNLEMPPDVIARLAARGADAGVRLRDRFRWDDHRWIRFRS
FT                   LLDVMQRYVAPAWAAHAPGTPGRAALLALLEAHRGGRGSYPVTGPQAECARAALEGVDR
FT                   LAEAAAATGGDLRERAPRPAPELRARPRV"
     MQTGTTEAEG LLECDLVMKG GITSGVVYPL ALVELARRYR FRSVGGSSAG AIAAAAAVAA        60
     EYGRQSGATV EGSGFAGLAR LPASLGERLP GGGSRLSSLF QPTRRTRPVL EALLGAARGR       120
     SAAGKAARAL APLVVAAPGC WVALAGLLLA GAVGAVAGRQ GGVAEAAALW LSAAAVLALA       180
     ALGAVVASAV SALGAIRDNG LGVCSGFAPP GRGGPPPLTT WLHGLVQSLA GTREVLTLGH       240
     LERHGLRLEV TTTSVTHQRP FRLPLHPDDP VFFFREAEFR ALFPGEVVDR LVEAGRAEEA       300
     ERRARTDGRR VRLPAHDPSL VLFPRGPGLP VVVLARMSLS FPLLLGAVPL YGVDWTRRRN       360
     QRRRAEPELE RAWFSDGGIC SNIPIHFFDA ALPTRPTFAI DLREQHPDHP LGAWLPANNA       420
     SGIAQRWRRL GEGRAAPLRF LAAVVATMQT WVDEMQLAAP GYRDRIVHVS HAADEGGLNL       480
     EMPPDVIARL AARGADAGVR LRDRFRWDDH RWIRFRSLLD VMQRYVAPAW AAHAPGTPGR       540
     AALLALLEAH RGGRGSYPVT GPQAECARAA LEGVDRLAEA AAATGGDLRE RAPRPAPELR       600
     ARPRV                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page