(data stored in ACNUC7421 zone)

EMBL: CP000251.PE534

CP000251.PE534       Location/Qualifiers
FT   CDS             627597..628340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0536"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80312"
FT                   /db_xref="GOA:Q2INC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80312.1"
FT                   /translation="MRDAREPGGQAAPGGAVGGAPERAAADASASRGAGLDGATLAHEL
FT                   KNPLTAVKALVQLGLGNPREAASHERLEHVARAVERMERILRDYLASARGMAELAPARV
FT                   EVGPLVSGVLQGLSARASEARVRLVTHGDATVEADPRRLEEALVNLVANGIEATPPGGE
FT                   VEVEVLSSAEGAELVVRDTGTGIAPDALQRLGTPFFSTRSGGNGLGVAHVRSVIAMHGG
FT                   SLQYESEPGKGTVVRATLPRRERAA"
     MRDAREPGGQ AAPGGAVGGA PERAAADASA SRGAGLDGAT LAHELKNPLT AVKALVQLGL        60
     GNPREAASHE RLEHVARAVE RMERILRDYL ASARGMAELA PARVEVGPLV SGVLQGLSAR       120
     ASEARVRLVT HGDATVEADP RRLEEALVNL VANGIEATPP GGEVEVEVLS SAEGAELVVR       180
     DTGTGIAPDA LQRLGTPFFS TRSGGNGLGV AHVRSVIAMH GGSLQYESEP GKGTVVRATL       240
     PRRERAA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page