(data stored in ACNUC7421 zone)

EMBL: CP000251.PE535

CP000251.PE535       Location/Qualifiers
FT   CDS             complement(628390..629133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80313"
FT                   /db_xref="GOA:Q2INC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80313.1"
FT                   /translation="MGVTGAPSWPAARRARGPLGEVDGRVVLLLALLFGVLVWRAGAAA
FT                   NAVYAAGFAAALAASGATAREARRLARWAGGFALLWGGVKLALDLAGGVPPAAALATAG
FT                   LLCLRLAALLLLGAAVSALVSPRALGLALATLTRPVLRDRAWSASLALLLMVHFVPRAL
FT                   AAFEAARAALRARRVRLSRTRALALVVEAGTRNLARMTWDQTLAVAARRLDRPEAWTGV
FT                   PPPRARDWCAGAAVAALAVAAAALL"
     MGVTGAPSWP AARRARGPLG EVDGRVVLLL ALLFGVLVWR AGAAANAVYA AGFAAALAAS        60
     GATAREARRL ARWAGGFALL WGGVKLALDL AGGVPPAAAL ATAGLLCLRL AALLLLGAAV       120
     SALVSPRALG LALATLTRPV LRDRAWSASL ALLLMVHFVP RALAAFEAAR AALRARRVRL       180
     SRTRALALVV EAGTRNLARM TWDQTLAVAA RRLDRPEAWT GVPPPRARDW CAGAAVAALA       240
     VAAAALL                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page