(data stored in ACNUC7421 zone)

EMBL: CP000251.PE539

CP000251.PE539       Location/Qualifiers
FT   CDS             631211..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80317"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IND2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80317.1"
FT                   /translation="MRPRFRACITAALACAAALAPARGLAGPPYTTDDPEPVPFRHWEV
FT                   YLATADQWSHADGWGGTCPHLEVNYGAIPGVQLHLVAPLAWARPPGGPGRAGPGDTELG
FT                   AKWRFLDEGTRRPQVGVFPLVELPTGDDRRGLGAGRAQVFLPVWVQKSLGAWTTYGGGG
FT                   YWLSPGAGNRNWWLVGWQAQRRVADGVALGAEVFHSSAREIGGRGDTRFDVGAVLDLGA
FT                   LHHVLVSAGRALGSRAAQAYLAYQLTFGPGGGPEERAASGAPR"
     MRPRFRACIT AALACAAALA PARGLAGPPY TTDDPEPVPF RHWEVYLATA DQWSHADGWG        60
     GTCPHLEVNY GAIPGVQLHL VAPLAWARPP GGPGRAGPGD TELGAKWRFL DEGTRRPQVG       120
     VFPLVELPTG DDRRGLGAGR AQVFLPVWVQ KSLGAWTTYG GGGYWLSPGA GNRNWWLVGW       180
     QAQRRVADGV ALGAEVFHSS AREIGGRGDT RFDVGAVLDL GALHHVLVSA GRALGSRAAQ       240
     AYLAYQLTFG PGGGPEERAA SGAPR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page