(data stored in ACNUC7421 zone)

EMBL: CP000251.PE545

CP000251.PE545       Location/Qualifiers
FT   CDS             complement(636103..636684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0547"
FT                   /product="FMN-binding pyridoxamine 5'-phosphate
FT                   oxidase-related protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80323"
FT                   /db_xref="GOA:Q2INE3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80323.1"
FT                   /translation="MGHRFAELAFTPAVRAVQESMGSRAAYARMEAGPDHHDALGPDEA
FT                   GFIAARDSFYLASVGETGWPYLQHRGGPPGFVRVLGPRTIGFADYRGNRQYVTVGNLAR
FT                   NDRVALFFMDYPARTRLKLLGHARWVGPEEPALLAALSAPAGAAPVERGIVIEVAAFDW
FT                   NCSQHITPRFTEAELEAGAGPDQPWVPAAK"
     MGHRFAELAF TPAVRAVQES MGSRAAYARM EAGPDHHDAL GPDEAGFIAA RDSFYLASVG        60
     ETGWPYLQHR GGPPGFVRVL GPRTIGFADY RGNRQYVTVG NLARNDRVAL FFMDYPARTR       120
     LKLLGHARWV GPEEPALLAA LSAPAGAAPV ERGIVIEVAA FDWNCSQHIT PRFTEAELEA       180
     GAGPDQPWVP AAK                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page