(data stored in ACNUC7421 zone)

EMBL: CP000251.PE551

CP000251.PE551       Location/Qualifiers
FT   CDS             642201..643394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0553"
FT                   /product="Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80329"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80329.1"
FT                   /translation="MKTTIIAGRLALACGAVLLGLGGGGVARATECGDLVTSSLKLEKD
FT                   LTCETSGLVIGADDVTIDLGGHTIASVPGAPGDVAWSGVKTEHTMTLRNVRVMNGTIVG
FT                   FRWGVAIRHGTAGAAIQNLAFADQADASVFVRDSSGVRITNVKVTDSGPISILNAGDVR
FT                   ISMAAIALASRSPAIIARNSAGVSIRTLAASGPIPSYYGDVVEPDSGILFERVTNADVQ
FT                   GVYVRGFKDGVGFTCPGCAPGDVPNSGSVRDSVFTDDQAGVNVEYASNVTVAGNHVARA
FT                   GRWHPVYWFVGGGITAAECTGLAVVDNAVSDSLQGLGFMDVTASRIEGNKVLDNVLSGI
FT                   GLNIQVGGSFGNTVASNIVLGTSTGFDIWAASGPNTWKGNLCRTASGEGVACAIVVP"
     MKTTIIAGRL ALACGAVLLG LGGGGVARAT ECGDLVTSSL KLEKDLTCET SGLVIGADDV        60
     TIDLGGHTIA SVPGAPGDVA WSGVKTEHTM TLRNVRVMNG TIVGFRWGVA IRHGTAGAAI       120
     QNLAFADQAD ASVFVRDSSG VRITNVKVTD SGPISILNAG DVRISMAAIA LASRSPAIIA       180
     RNSAGVSIRT LAASGPIPSY YGDVVEPDSG ILFERVTNAD VQGVYVRGFK DGVGFTCPGC       240
     APGDVPNSGS VRDSVFTDDQ AGVNVEYASN VTVAGNHVAR AGRWHPVYWF VGGGITAAEC       300
     TGLAVVDNAV SDSLQGLGFM DVTASRIEGN KVLDNVLSGI GLNIQVGGSF GNTVASNIVL       360
     GTSTGFDIWA ASGPNTWKGN LCRTASGEGV ACAIVVP                                397
//

If you have problems or comments...

PBIL Back to PBIL home page