(data stored in ACNUC7421 zone)

EMBL: CP000251.PE553

CP000251.PE553       Location/Qualifiers
FT   CDS             complement(644323..644745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80331"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80331.1"
FT                   /translation="MSRARWKVVLVLALVFLAGGVSGAVVSRAVVQRAVGRLLEGPPEQ
FT                   ARASAILFRLDRDLDLTREQRGELRAVLARHRGELAAIRRTVAPQLEAARRRQWAEMRE
FT                   VLDERQRDGFDRFVEELERRVARSLAAPPSAAAPIE"
     MSRARWKVVL VLALVFLAGG VSGAVVSRAV VQRAVGRLLE GPPEQARASA ILFRLDRDLD        60
     LTREQRGELR AVLARHRGEL AAIRRTVAPQ LEAARRRQWA EMREVLDERQ RDGFDRFVEE       120
     LERRVARSLA APPSAAAPIE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page