(data stored in ACNUC7421 zone)

EMBL: CP000251.PE557

CP000251.PE557       Location/Qualifiers
FT   CDS             646373..646744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80335"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80335.1"
FT                   /translation="MIAPLAALSSLAVAATVVVTHPRTVVVAPRPRAVVVVPARPPPPP
FT                   PAPPPMSRREAVERGYGWCGGSGYACVLVEAHPRGTVWDVHFRASRPGVTGPLRVTFDR
FT                   QTRALVEAVEPGPRAPPAR"
     MIAPLAALSS LAVAATVVVT HPRTVVVAPR PRAVVVVPAR PPPPPPAPPP MSRREAVERG        60
     YGWCGGSGYA CVLVEAHPRG TVWDVHFRAS RPGVTGPLRV TFDRQTRALV EAVEPGPRAP       120
     PAR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page