(data stored in ACNUC7421 zone)

EMBL: CP000251.PE558

CP000251.PE558       Location/Qualifiers
FT   CDS             complement(646963..649308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80336"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80336.1"
FT                   /translation="MHPAPGEPRRRGDEALPDAAGDDRLHHPAPILRSVPGVEPPAAAG
FT                   WGGRRHPGLRVPCILLTGGGTHELVEAEACGRAGRFGPVPRQVGGAAGGLRLAGRPGRA
FT                   PGRGDARRRGRLVREARARPLGRGDAGGPPRPAAPAGRPRRHGRTADARGEGRGEGVPV
FT                   RGGHHHRLAFGERARRPQGPAALPAGDHGRRGGGRGGPPEPGVLVPRRPRRRARPRRRP
FT                   RHRRHLHHAPAVRPGRAGRRRGRERGGVLAPQPRPEGDRVLGLRRAPAGPGGARPRARS
FT                   APRARLRRGRGAARAGRDAHAARRFRAGPRRSGAHLPRRHGPRPRRLPVFRGRRAPDRP
FT                   RRHLRSGERRLAPAAARPRRAAPVAPPAGPGAGGGADPVLDRRHGAHGAARPGDARRPA
FT                   RRGRGARGVRVRGAGEARRPRGRRGRGRPRAPVVRGAWLPAGRGGRHPRQHALPRRGPE
FT                   AGRSRRPLAGPAQRLGDVHAGGPDRSAPDAHAPHDPRAPPGAPGGDARGRLAGPERGGL
FT                   DAALPGAVGCDLEVPRLARERLGALRRGRGRLRPQPRGAFAPQLDDLRRHRGGLRRVEA
FT                   DGPGAANRPALAGEERLELRSVERSDEREHLVRALPADGLQRLLVKPRLAPVPGGIAHE
FT                   VARADVQHRQDRRILARRVDLGEGERAIHARVERGRLLLERVPVGRFGLGIGVDADVLV
FT                   PEPVDGADRDALGLAEPAHVGHLERPVLEASEREGLGANLDEDEVGTIRLDEPGQIRER
FT                   ILGLGEVRPVDRPHDHRLEARGRRIAWR"
     MHPAPGEPRR RGDEALPDAA GDDRLHHPAP ILRSVPGVEP PAAAGWGGRR HPGLRVPCIL        60
     LTGGGTHELV EAEACGRAGR FGPVPRQVGG AAGGLRLAGR PGRAPGRGDA RRRGRLVREA       120
     RARPLGRGDA GGPPRPAAPA GRPRRHGRTA DARGEGRGEG VPVRGGHHHR LAFGERARRP       180
     QGPAALPAGD HGRRGGGRGG PPEPGVLVPR RPRRRARPRR RPRHRRHLHH APAVRPGRAG       240
     RRRGRERGGV LAPQPRPEGD RVLGLRRAPA GPGGARPRAR SAPRARLRRG RGAARAGRDA       300
     HAARRFRAGP RRSGAHLPRR HGPRPRRLPV FRGRRAPDRP RRHLRSGERR LAPAAARPRR       360
     AAPVAPPAGP GAGGGADPVL DRRHGAHGAA RPGDARRPAR RGRGARGVRV RGAGEARRPR       420
     GRRGRGRPRA PVVRGAWLPA GRGGRHPRQH ALPRRGPEAG RSRRPLAGPA QRLGDVHAGG       480
     PDRSAPDAHA PHDPRAPPGA PGGDARGRLA GPERGGLDAA LPGAVGCDLE VPRLARERLG       540
     ALRRGRGRLR PQPRGAFAPQ LDDLRRHRGG LRRVEADGPG AANRPALAGE ERLELRSVER       600
     SDEREHLVRA LPADGLQRLL VKPRLAPVPG GIAHEVARAD VQHRQDRRIL ARRVDLGEGE       660
     RAIHARVERG RLLLERVPVG RFGLGIGVDA DVLVPEPVDG ADRDALGLAE PAHVGHLERP       720
     VLEASEREGL GANLDEDEVG TIRLDEPGQI RERILGLGEV RPVDRPHDHR LEARGRRIAW       780
     R                                                                       781
//

If you have problems or comments...

PBIL Back to PBIL home page