(data stored in ACNUC7421 zone)

EMBL: CP000251.PE559

CP000251.PE559       Location/Qualifiers
FT   CDS             649314..649886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0561"
FT                   /product="protein of unknown function DUF1211"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80337"
FT                   /db_xref="GOA:Q2INF3"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80337.1"
FT                   /translation="MNKGRLEAFSDGVLAIIITIMVLELKVPPGDTLEALAAMRSTFLG
FT                   YVLSFVYVGIYWNNHHHLMHTVHHVTGSIMWANLHLLFWLSLVPAVTAWADHYPSSPLP
FT                   TALYGVVLLAAALAWLVLQRAIIRAGGSLRLMIGADLKGKLSPILYLIAIALSFVRTWA
FT                   ADAVYALVAALWFIPDRRIERRSGAGE"
     MNKGRLEAFS DGVLAIIITI MVLELKVPPG DTLEALAAMR STFLGYVLSF VYVGIYWNNH        60
     HHLMHTVHHV TGSIMWANLH LLFWLSLVPA VTAWADHYPS SPLPTALYGV VLLAAALAWL       120
     VLQRAIIRAG GSLRLMIGAD LKGKLSPILY LIAIALSFVR TWAADAVYAL VAALWFIPDR       180
     RIERRSGAGE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page