(data stored in ACNUC7421 zone)

EMBL: CP000251.PE56

CP000251.PE56        Location/Qualifiers
FT   CDS             68315..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0056"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79834"
FT                   /db_xref="GOA:Q2IM03"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79834.1"
FT                   /translation="MIQLTVSADAAGQRLDKLVRKALRDVPLSHVYKMFRTRKVRVNGA
FT                   RGKADQVVAEGDVVVIRGDEERLLAKAAPAAPGGAPRVTFGVLHEDADLLAVDKPAGLA
FT                   AHPGTGIEGATLVEMARGYLKTPDDLPPTEFKPSPAHRLDRDTSGVVLVAKHRKAMVRL
FT                   GETFTTGEGVHKTYLALVKGKMPREAGTIDLPLSEHEQTSKSKAMRGVNFQEALTRWKV
FT                   VSAAKEISLLAVTIETGRTHQIRRHLEAVGHPVAGDRRYGDFAFNRTARTRWGLRRMGL
FT                   HAWRLEVPHPLTGAPLRLEAPFPAELAEVLSRANLKLPASPTGAHAPGARREGPHRER"
     MIQLTVSADA AGQRLDKLVR KALRDVPLSH VYKMFRTRKV RVNGARGKAD QVVAEGDVVV        60
     IRGDEERLLA KAAPAAPGGA PRVTFGVLHE DADLLAVDKP AGLAAHPGTG IEGATLVEMA       120
     RGYLKTPDDL PPTEFKPSPA HRLDRDTSGV VLVAKHRKAM VRLGETFTTG EGVHKTYLAL       180
     VKGKMPREAG TIDLPLSEHE QTSKSKAMRG VNFQEALTRW KVVSAAKEIS LLAVTIETGR       240
     THQIRRHLEA VGHPVAGDRR YGDFAFNRTA RTRWGLRRMG LHAWRLEVPH PLTGAPLRLE       300
     APFPAELAEV LSRANLKLPA SPTGAHAPGA RREGPHRER                              339
//

If you have problems or comments...

PBIL Back to PBIL home page