(data stored in ACNUC7421 zone)

EMBL: CP000251.PE560

CP000251.PE560       Location/Qualifiers
FT   CDS             complement(649902..650633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0562"
FT                   /product="DNA mismatch repair protein MutS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80338"
FT                   /db_xref="GOA:Q2INF6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80338.1"
FT                   /translation="MRGWLTALGEMEALAALATRVYENPAEQFPEVVSTGTMLDAQELG
FT                   HPLLPVERCVRNDVRLGGTAPQLILLSGSNMSGKSTLLRALGASAALALAGGTVRARRM
FT                   VLSPVALCASLRVQDSVLDGASRFQAEVLRLCDVARFAAGPHAVLFLLDEILGGTNSDD
FT                   RLRGAKGVLTALVNRGAIGVCTTHDLALTRIADELGARATNAHLVDALVGGKLAFDYRL
FT                   RPGVVRRSNAIEWMRLVGLEV"
     MRGWLTALGE MEALAALATR VYENPAEQFP EVVSTGTMLD AQELGHPLLP VERCVRNDVR        60
     LGGTAPQLIL LSGSNMSGKS TLLRALGASA ALALAGGTVR ARRMVLSPVA LCASLRVQDS       120
     VLDGASRFQA EVLRLCDVAR FAAGPHAVLF LLDEILGGTN SDDRLRGAKG VLTALVNRGA       180
     IGVCTTHDLA LTRIADELGA RATNAHLVDA LVGGKLAFDY RLRPGVVRRS NAIEWMRLVG       240
     LEV                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page