(data stored in ACNUC7421 zone)

EMBL: CP000251.PE561

CP000251.PE561       Location/Qualifiers
FT   CDS             complement(651423..652646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0563"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80339"
FT                   /db_xref="GOA:Q2ING0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80339.1"
FT                   /translation="MISVLVVDDDRLKTTLIRQALRELATDIRVTGASNIVDALKLLRA
FT                   ESFDLLIVDLNVPMRKGESARPDGGVQLVELLRRGRGPLPAHIVALTEYDDLASQHQKA
FT                   FSGDLIYVVRFDRSSRAWSEAIGRKLLAIERSQAPRERGGYDYDLAVVTALTRVELEAV
FT                   LELPISWRRRNVPEDDTIYHEGCLKRAEGDLRVIAAAAPEMGMPATTALAMKMICGFRP
FT                   RYIAMVGIAAGLKGGFGDVLIADISWDYGSGKFKERPDGKGGVFEPGPTQLRLDARVRA
FT                   RLEDFSRDQTVAQRILHRWNGDPVPRQIEVAIGPVASGAAVVDSHEMIEQIRAQQRKVV
FT                   GVEMETYGVFMAARNAPEPKPIALSFKSVSDFGSQKGDDYQRFAAFTSAQFLYEFACSG
FT                   LEWPHSRS"
     MISVLVVDDD RLKTTLIRQA LRELATDIRV TGASNIVDAL KLLRAESFDL LIVDLNVPMR        60
     KGESARPDGG VQLVELLRRG RGPLPAHIVA LTEYDDLASQ HQKAFSGDLI YVVRFDRSSR       120
     AWSEAIGRKL LAIERSQAPR ERGGYDYDLA VVTALTRVEL EAVLELPISW RRRNVPEDDT       180
     IYHEGCLKRA EGDLRVIAAA APEMGMPATT ALAMKMICGF RPRYIAMVGI AAGLKGGFGD       240
     VLIADISWDY GSGKFKERPD GKGGVFEPGP TQLRLDARVR ARLEDFSRDQ TVAQRILHRW       300
     NGDPVPRQIE VAIGPVASGA AVVDSHEMIE QIRAQQRKVV GVEMETYGVF MAARNAPEPK       360
     PIALSFKSVS DFGSQKGDDY QRFAAFTSAQ FLYEFACSGL EWPHSRS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page