(data stored in ACNUC7421 zone)

EMBL: CP000251.PE562

CP000251.PE562       Location/Qualifiers
FT   CDS             complement(652643..653056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0564"
FT                   /product="response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80340"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80340.1"
FT                   /translation="MRFLRTEFPTASVTAAQSYQSGLKAALGDTFDAIILDMSLPTYDI
FT                   SASNSGGRTRGYGGREFLEALKRRRRNTKVVVVTQFDTFGEGADAMNLTQLTEQLRAEY
FT                   PDIYVGTAFYQASQTAWRDELQAYLKSVSGDLS"
     MRFLRTEFPT ASVTAAQSYQ SGLKAALGDT FDAIILDMSL PTYDISASNS GGRTRGYGGR        60
     EFLEALKRRR RNTKVVVVTQ FDTFGEGADA MNLTQLTEQL RAEYPDIYVG TAFYQASQTA       120
     WRDELQAYLK SVSGDLS                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page