(data stored in ACNUC7421 zone)

EMBL: CP000251.PE565

CP000251.PE565       Location/Qualifiers
FT   CDS             657850..660546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0567"
FT                   /product="RNA polymerase associated protein rapA"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80343"
FT                   /db_xref="GOA:Q2ING2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80343.1"
FT                   /translation="MAWKAGMKVVHRAQRAWGVGVVVQVADEGRRLAVRFAGREGITVV
FT                   SGRDQALVEVPADTPIEQVASGPIEALASAQPATASAFALRTRVNRLEALRRADSLGAL
FT                   LSSRVHVLPHQVGAAGRILSDRMPRFVLADEVGLGKTVEAGLVFAGMRQLGLAERVLVV
FT                   VPEHLAFQWLAELFHKFNALFALLTPERIEALGGPEAALARSPHAIVSFEALRADPELA
FT                   EAAADLPLDLVVVDEAHHLADDALHDRVAPICRASFGVLLLTATPVRLDPREYFRLLSL
FT                   VEPVPSTSLDDFLARLEQHEAYAQVARDLLAGGDLAAAAERLRALAPDDLVFSKAPPAL
FT                   DRGALLAHLAERYGLSSRLIRNRRVKVGAFTSRALRRVDVGEGEKPKALVDLCARLARA
FT                   GDKVLVFGGDLEALRGLQGGLAEAGLEALLYDDAPSLEARDRLVARFRDPEGPMLLLSG
FT                   ESGGEGRNFQFAHHLVCADLPASPLVLEQRIGRLDRLGQTRPVEIHVPVEPGDEAFLAD
FT                   LYEQEIGIFDEPVGGLDAVLASLPDELAALARKRSDRTREAFRKDLAKRVAAARKAQHE
FT                   GDPLLDIRSASLPELARLVRGAFERMGEEAPDGIDGGDGAGSALEQSLITLSRWLEEEL
FT                   EDVCADVGRRVGMDVDTDQNVQPFEVAFTLGSGMRIEALPGMQIPDEPETFVGSFWRET
FT                   AVARDELHWYATGHKLVEALLGLVRDGDAGRSAAVKREWAPRRGGLYARFEPRLATAAD
FT                   VAPGARVASRQASRYLDLSPIAVVVDLEAGNRVLPGAAHRLEDEIDDVQDARVGAPPPA
FT                   ALEAARAAAEREARLVMERRREEAVGLLLAHADAEEERLIEAAFAGGAPRERIDGALAV
FT                   LRHHRDVVAKSIERVKLDLDAAALIVP"
     MAWKAGMKVV HRAQRAWGVG VVVQVADEGR RLAVRFAGRE GITVVSGRDQ ALVEVPADTP        60
     IEQVASGPIE ALASAQPATA SAFALRTRVN RLEALRRADS LGALLSSRVH VLPHQVGAAG       120
     RILSDRMPRF VLADEVGLGK TVEAGLVFAG MRQLGLAERV LVVVPEHLAF QWLAELFHKF       180
     NALFALLTPE RIEALGGPEA ALARSPHAIV SFEALRADPE LAEAAADLPL DLVVVDEAHH       240
     LADDALHDRV APICRASFGV LLLTATPVRL DPREYFRLLS LVEPVPSTSL DDFLARLEQH       300
     EAYAQVARDL LAGGDLAAAA ERLRALAPDD LVFSKAPPAL DRGALLAHLA ERYGLSSRLI       360
     RNRRVKVGAF TSRALRRVDV GEGEKPKALV DLCARLARAG DKVLVFGGDL EALRGLQGGL       420
     AEAGLEALLY DDAPSLEARD RLVARFRDPE GPMLLLSGES GGEGRNFQFA HHLVCADLPA       480
     SPLVLEQRIG RLDRLGQTRP VEIHVPVEPG DEAFLADLYE QEIGIFDEPV GGLDAVLASL       540
     PDELAALARK RSDRTREAFR KDLAKRVAAA RKAQHEGDPL LDIRSASLPE LARLVRGAFE       600
     RMGEEAPDGI DGGDGAGSAL EQSLITLSRW LEEELEDVCA DVGRRVGMDV DTDQNVQPFE       660
     VAFTLGSGMR IEALPGMQIP DEPETFVGSF WRETAVARDE LHWYATGHKL VEALLGLVRD       720
     GDAGRSAAVK REWAPRRGGL YARFEPRLAT AADVAPGARV ASRQASRYLD LSPIAVVVDL       780
     EAGNRVLPGA AHRLEDEIDD VQDARVGAPP PAALEAARAA AEREARLVME RRREEAVGLL       840
     LAHADAEEER LIEAAFAGGA PRERIDGALA VLRHHRDVVA KSIERVKLDL DAAALIVP         898
//

If you have problems or comments...

PBIL Back to PBIL home page