(data stored in ACNUC7421 zone)

EMBL: CP000251.PE569

CP000251.PE569       Location/Qualifiers
FT   CDS             664217..666085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0571"
FT                   /product="putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80347"
FT                   /db_xref="GOA:Q2ING6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ING6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80347.1"
FT                   /translation="MANGRILVVDDERFFQELFRDVLAGAGHAVRTSSSAEEALEVLAA
FT                   ERVDLLLTDMVMPGLDGLGLIREARRRDPELEVVAVTGREDVKLAVESMKAGCSDFLTK
FT                   PLEPGELLRVAERVLARVRLRREHSQLLTENLEFVKAQALYRQGLQILATLDGERLVDL
FT                   ALSVLARTTDAQGAALWVADEKGQLALRGYRGLVDRAALPVRVDPRDPAFADALRGGAP
FT                   FQAPEGWGGEAFLVPLVADDEPLGLALLSDRARGRFGRDEHAAALMVADFAAIAVKNAR
FT                   RFQAVERVGLRDRETGAYNLSYFVDYAGKEFYKARRYGRAFSLVVLSVDNVEQLRKEAG
FT                   REPFRRLMRDLVAAVGRAVRDADILAKVSESEYYVLLPETDYFGALMFVRRATEEVRRE
FT                   ASVRTMEERVPVLLSIGAGSFPKDGEDFDELLHWARDRVQDQRGSLLRRLHLGDLEPGA
FT                   FWELTDVLLSGSARLPDSSASARLQPDPELFAAAQREAAREIARDPRARGLLYVGLRSA
FT                   LAASPVRAALPAGDPAARAGDPSARVYLLGPRGTDVEAAPHPLVTEVYVDGDQRFAGHE
FT                   FLLFLSERSAYALLSGPDGRTFHTSDMPLVDALVSKLQTAYDLQPI"
     MANGRILVVD DERFFQELFR DVLAGAGHAV RTSSSAEEAL EVLAAERVDL LLTDMVMPGL        60
     DGLGLIREAR RRDPELEVVA VTGREDVKLA VESMKAGCSD FLTKPLEPGE LLRVAERVLA       120
     RVRLRREHSQ LLTENLEFVK AQALYRQGLQ ILATLDGERL VDLALSVLAR TTDAQGAALW       180
     VADEKGQLAL RGYRGLVDRA ALPVRVDPRD PAFADALRGG APFQAPEGWG GEAFLVPLVA       240
     DDEPLGLALL SDRARGRFGR DEHAAALMVA DFAAIAVKNA RRFQAVERVG LRDRETGAYN       300
     LSYFVDYAGK EFYKARRYGR AFSLVVLSVD NVEQLRKEAG REPFRRLMRD LVAAVGRAVR       360
     DADILAKVSE SEYYVLLPET DYFGALMFVR RATEEVRREA SVRTMEERVP VLLSIGAGSF       420
     PKDGEDFDEL LHWARDRVQD QRGSLLRRLH LGDLEPGAFW ELTDVLLSGS ARLPDSSASA       480
     RLQPDPELFA AAQREAAREI ARDPRARGLL YVGLRSALAA SPVRAALPAG DPAARAGDPS       540
     ARVYLLGPRG TDVEAAPHPL VTEVYVDGDQ RFAGHEFLLF LSERSAYALL SGPDGRTFHT       600
     SDMPLVDALV SKLQTAYDLQ PI                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page