(data stored in ACNUC7421 zone)

EMBL: CP000251.PE572

CP000251.PE572       Location/Qualifiers
FT   CDS             complement(668402..668719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80350"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80350.1"
FT                   /translation="MADFVIRAVERLREDPGFSRNRYFLALSSPEGKRALRIHRHLRSL
FT                   EHDLSDGATATVARDAERVRLTLRGKRGARTAWLTRAEYRLLLTSPVARAALAAAELEP
FT                   G"
     MADFVIRAVE RLREDPGFSR NRYFLALSSP EGKRALRIHR HLRSLEHDLS DGATATVARD        60
     AERVRLTLRG KRGARTAWLT RAEYRLLLTS PVARAALAAA ELEPG                       105
//

If you have problems or comments...

PBIL Back to PBIL home page