(data stored in ACNUC7421 zone)

EMBL: CP000251.PE576

CP000251.PE576       Location/Qualifiers
FT   CDS             672547..673416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0578"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80354"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80354.1"
FT                   /translation="MTGLALVVALVGIAIAVLSYRSASAARAALAARTAEDVKRGEELE
FT                   AARKAERAARAEAKERRDEATAVKAELERSKKKAFEQQEAAKKAGGAQALRVELDKLAA
FT                   RLAEARAEAEHQTTRARALEKELEKAAAAVKRLEARPAVAAAPAPAPVAPVPQAAAPAA
FT                   PAVDDGRLAAEKDRADKAEAKLAEARKRVADLEKDVKNVRGRLETEKRVYIVQKSELEL
FT                   AGDRYAELRRRHEALRKDHDELVEAVRQAAREERRLTQQEAARAEAATPPAAPEGEGEG
FT                   DAGGSSAA"
     MTGLALVVAL VGIAIAVLSY RSASAARAAL AARTAEDVKR GEELEAARKA ERAARAEAKE        60
     RRDEATAVKA ELERSKKKAF EQQEAAKKAG GAQALRVELD KLAARLAEAR AEAEHQTTRA       120
     RALEKELEKA AAAVKRLEAR PAVAAAPAPA PVAPVPQAAA PAAPAVDDGR LAAEKDRADK       180
     AEAKLAEARK RVADLEKDVK NVRGRLETEK RVYIVQKSEL ELAGDRYAEL RRRHEALRKD       240
     HDELVEAVRQ AAREERRLTQ QEAARAEAAT PPAAPEGEGE GDAGGSSAA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page