(data stored in ACNUC7421 zone)

EMBL: CP000251.PE577

CP000251.PE577       Location/Qualifiers
FT   CDS             complement(673577..674203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABC80355"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/TrEMBL:Q2INH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC80355.1"
FT                   /translation="MAGLGLGPPDFALFELGDPDERARALDEELQPKLLALGVQCNSGL
FT                   ARVAGKELFVHPGKLPRRRNAAPEEVLVAFSDSPKGYRGLAFLAVVMTREHLHARVGVR
FT                   GDSPRRAGMQRALEREAANLARKGKPFRKLREFLEWNHEELPELAPAHSAAFWLEMGEA
FT                   LAPGGPGLDLGIAWSQEEARSIALGDLLGVFRDLAPLYKVLANAE"
     MAGLGLGPPD FALFELGDPD ERARALDEEL QPKLLALGVQ CNSGLARVAG KELFVHPGKL        60
     PRRRNAAPEE VLVAFSDSPK GYRGLAFLAV VMTREHLHAR VGVRGDSPRR AGMQRALERE       120
     AANLARKGKP FRKLREFLEW NHEELPELAP AHSAAFWLEM GEALAPGGPG LDLGIAWSQE       180
     EARSIALGDL LGVFRDLAPL YKVLANAE                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page