(data stored in ACNUC7421 zone)

EMBL: CP000251.PE59

CP000251.PE59        Location/Qualifiers
FT   CDS             complement(74302..74766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0059"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79837"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79837.1"
FT                   /translation="MPRLTSPRMAYWLLKTEPGTYAWSDLVADGTTPWTGVANPQAQAN
FT                   LRAMKAGDRAIVYHSGEKRAVGIAEVVRTAYPDPTAGGELVCVDVKAVEPLPAPVPLEA
FT                   LKLEPAFEGSVLLRQGRLSVVPLAPAEWRDLAALADVIARTGGLRRKARF"
     MPRLTSPRMA YWLLKTEPGT YAWSDLVADG TTPWTGVANP QAQANLRAMK AGDRAIVYHS        60
     GEKRAVGIAE VVRTAYPDPT AGGELVCVDV KAVEPLPAPV PLEALKLEPA FEGSVLLRQG       120
     RLSVVPLAPA EWRDLAALAD VIARTGGLRR KARF                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page