(data stored in ACNUC7421 zone)

EMBL: CP000251.PE60

CP000251.PE60        Location/Qualifiers
FT   CDS             74838..75278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0060"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79838"
FT                   /db_xref="GOA:Q2IM07"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79838.1"
FT                   /translation="MFGLSFGEIVIIAVLALILLGPDRLPEAAKTIGKGLRQFKQATDD
FT                   LKDQIETEIYKDDRKVARPSLVPPVPNRPVPGPAGPPPAATAENVPGLEAALVDAEPAA
FT                   SAVEPAAAAAQPAAVATAPAPSPSPEPSGEGAPPPGTGGTAA"
     MFGLSFGEIV IIAVLALILL GPDRLPEAAK TIGKGLRQFK QATDDLKDQI ETEIYKDDRK        60
     VARPSLVPPV PNRPVPGPAG PPPAATAENV PGLEAALVDA EPAASAVEPA AAAAQPAAVA       120
     TAPAPSPSPE PSGEGAPPPG TGGTAA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page