(data stored in ACNUC7421 zone)

EMBL: CP000251.PE67

CP000251.PE67        Location/Qualifiers
FT   CDS             83841..84452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79845"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79845.1"
FT                   /translation="MPQTRPILAAALLSLGIAQAARAADPAPAPAKPAATPAPAAKPSP
FT                   TAMDLARTLATQETWKRGMDGLTQSVVGQFRGHPGSELSMPKDFQAKARTEIEALLPYE
FT                   ELVNIHARQLSAAYGEAEMKDLLAFYKSPLGQKTLKAMPEVQEKVAVETQQRIEPKLPQ
FT                   VMQKLAKDVKPPAGGAKAPSNPHGAAPAKAAPAKPAQPKK"
     MPQTRPILAA ALLSLGIAQA ARAADPAPAP AKPAATPAPA AKPSPTAMDL ARTLATQETW        60
     KRGMDGLTQS VVGQFRGHPG SELSMPKDFQ AKARTEIEAL LPYEELVNIH ARQLSAAYGE       120
     AEMKDLLAFY KSPLGQKTLK AMPEVQEKVA VETQQRIEPK LPQVMQKLAK DVKPPAGGAK       180
     APSNPHGAAP AKAAPAKPAQ PKK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page