(data stored in ACNUC7421 zone)

EMBL: CP000251.PE68

CP000251.PE68        Location/Qualifiers
FT   CDS             84535..85278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0068"
FT                   /product="Lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79846"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79846.1"
FT                   /translation="MTPPPPLRAGRLVRPAVALAVFLAAGAAPRAAPAPLVYVALGDST
FT                   AAGQGGGPGGGYPPRLARRLEGAGLAVKLVNLGVPGATAADLRRDQLPRALEAGPGLVT
FT                   VGIGINDLVQGRPLRDFARDLEVVADFLRHTRAVVVISSLPDLGDSPSAEGAPAALLRR
FT                   LDQYNAAIARVAERHGFLVADAFGETRRTVKRLGPAAVFAGDGFHPSAAGYDAWAEALW
FT                   GPVERALGARLQGRRPPAPAAAGRP"
     MTPPPPLRAG RLVRPAVALA VFLAAGAAPR AAPAPLVYVA LGDSTAAGQG GGPGGGYPPR        60
     LARRLEGAGL AVKLVNLGVP GATAADLRRD QLPRALEAGP GLVTVGIGIN DLVQGRPLRD       120
     FARDLEVVAD FLRHTRAVVV ISSLPDLGDS PSAEGAPAAL LRRLDQYNAA IARVAERHGF       180
     LVADAFGETR RTVKRLGPAA VFAGDGFHPS AAGYDAWAEA LWGPVERALG ARLQGRRPPA       240
     PAAAGRP                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page