(data stored in ACNUC7421 zone)

EMBL: CP000251.PE7

CP000251.PE7         Location/Qualifiers
FT   CDS             8483..9259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79785"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79785.1"
FT                   /translation="MSCGACCGLYNAEDLSRPSLHAELARRTRVLREVERTPAAFHAAA
FT                   AALAVGGPAPLFPSVRVCPLLGFLDEAESRVGCLAHPAANGGVDLRDCGVYDVATCDAF
FT                   LCPSHAWLSEEEAAIAAAACDDYHLYGLVITDVEFVRAALAGVAVRAGARVELRHLEHP
FT                   PFRAALRELFALKEELAPGSDGLFGAFRPGADGEPVARRIDYEALGRTGGSPHDRILTC
FT                   VGADPRSGNDLEALEAEVRRRLDACAEVFGGTRPPG"
     MSCGACCGLY NAEDLSRPSL HAELARRTRV LREVERTPAA FHAAAAALAV GGPAPLFPSV        60
     RVCPLLGFLD EAESRVGCLA HPAANGGVDL RDCGVYDVAT CDAFLCPSHA WLSEEEAAIA       120
     AAACDDYHLY GLVITDVEFV RAALAGVAVR AGARVELRHL EHPPFRAALR ELFALKEELA       180
     PGSDGLFGAF RPGADGEPVA RRIDYEALGR TGGSPHDRIL TCVGADPRSG NDLEALEAEV       240
     RRRLDACAEV FGGTRPPG                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page