(data stored in ACNUC7421 zone)

EMBL: CP000251.PE89

CP000251.PE89        Location/Qualifiers
FT   CDS             108646..110064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0090"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79867"
FT                   /db_xref="GOA:Q2IM36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79867.1"
FT                   /translation="MLDVADAALRAAVADAVREARRRSAEAVAWMRVALRAAILLVYLP
FT                   GWHGTAAWHAAALRVSAAYLAVAVGVLVLLRRRWRWEAVALAAAAVDLAFVAVGSWRVV
FT                   ALAGGDLALAIAAGAGNGMMLMVILFAAVALPPAPAAALSVIAIANQMALAAHSGVSWR
FT                   LVLLVGLILSAAAIVAIRNTLRATALGARLAAESYTASLCRAHGEALARANAEALAQRD
FT                   EVITAHRQARDLVRLMVHDLKNPLAALLQYLRLAEVELRGQPDAAQVREDLAQAEGEGQ
FT                   RLAEMIGDLLAISRLETGPARLAADPVAIEDLLQAVARSCAAHARERGVTISVRGGDDL
FT                   VVRLDRDLSRRLLENLVANALRHCRTGDRIELAGEADGEGVRLAVRNSGPPVPPAIRAH
FT                   LFEKFAPGEAREWTSAGLGLYLCRLVAEAHGGGVALVDTPGWTVSFEARLAPARTGGEA
FT                   APRAAAVAPERRPG"
     MLDVADAALR AAVADAVREA RRRSAEAVAW MRVALRAAIL LVYLPGWHGT AAWHAAALRV        60
     SAAYLAVAVG VLVLLRRRWR WEAVALAAAA VDLAFVAVGS WRVVALAGGD LALAIAAGAG       120
     NGMMLMVILF AAVALPPAPA AALSVIAIAN QMALAAHSGV SWRLVLLVGL ILSAAAIVAI       180
     RNTLRATALG ARLAAESYTA SLCRAHGEAL ARANAEALAQ RDEVITAHRQ ARDLVRLMVH       240
     DLKNPLAALL QYLRLAEVEL RGQPDAAQVR EDLAQAEGEG QRLAEMIGDL LAISRLETGP       300
     ARLAADPVAI EDLLQAVARS CAAHARERGV TISVRGGDDL VVRLDRDLSR RLLENLVANA       360
     LRHCRTGDRI ELAGEADGEG VRLAVRNSGP PVPPAIRAHL FEKFAPGEAR EWTSAGLGLY       420
     LCRLVAEAHG GGVALVDTPG WTVSFEARLA PARTGGEAAP RAAAVAPERR PG               472
//

If you have problems or comments...

PBIL Back to PBIL home page