(data stored in ACNUC7421 zone)

EMBL: CP000251.PE9

CP000251.PE9         Location/Qualifiers
FT   CDS             complement(11509..12621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79787"
FT                   /db_xref="UniProtKB/TrEMBL:Q2ILV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79787.1"
FT                   /translation="MAAAMLALEFRRRAARRSRGARRSEEPTMKRTLAILAPLAIAASG
FT                   CVVATPVPSEPPPVAMPAPPQPLQVWYYGEHFVPDTFGGGWCYEPGAHWHDYYPDQPSA
FT                   YVLDGGYYFYRGPLVFTYWEGHPVPGGGWCYVRGPHRHDYYPPRGNDWQWRRGRGWAYR
FT                   GNWRPERPPPPAYWPSRPAPYPSRPAPAPAPAPYPGRPAPAPYPGRPAPAPAPAPAPYP
FT                   DRPYPGRPAPAPAPAPLPAPAPYPGRPVPAPAPAPAPDERGHRDDAPGHGTLPPGHGGT
FT                   PPGQAAPAYPAPGRGNDRGNVQPPGHGGTPPGRAAPAPAPAPAPRDDARGGGNGQGRRD
FT                   DKGDKGDGGKKDDRKSRQQDDLKDRRFQRL"
     MAAAMLALEF RRRAARRSRG ARRSEEPTMK RTLAILAPLA IAASGCVVAT PVPSEPPPVA        60
     MPAPPQPLQV WYYGEHFVPD TFGGGWCYEP GAHWHDYYPD QPSAYVLDGG YYFYRGPLVF       120
     TYWEGHPVPG GGWCYVRGPH RHDYYPPRGN DWQWRRGRGW AYRGNWRPER PPPPAYWPSR       180
     PAPYPSRPAP APAPAPYPGR PAPAPYPGRP APAPAPAPAP YPDRPYPGRP APAPAPAPLP       240
     APAPYPGRPV PAPAPAPAPD ERGHRDDAPG HGTLPPGHGG TPPGQAAPAY PAPGRGNDRG       300
     NVQPPGHGGT PPGRAAPAPA PAPAPRDDAR GGGNGQGRRD DKGDKGDGGK KDDRKSRQQD       360
     DLKDRRFQRL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page