(data stored in ACNUC7421 zone)

EMBL: CP000251.PE90

CP000251.PE90        Location/Qualifiers
FT   CDS             110074..110931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0091"
FT                   /product="protein of unknown function DUF1684"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79868"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79868.1"
FT                   /translation="MPGNLAPLSFVLLTLVLAACKSRPPADPAFAAEWKGWHDRREERL
FT                   RMPTGWLALTGLHWLEPGENRIPGLPGTFTLEGGRVTLAAARSDGYVLGGAPLERRALA
FT                   PDSAGEPDRVQLGASVTLAVIERSGRFAVRVWDAAAPARTGFRGIDAYPPDPRWRIEAR
FT                   WEAYPAPREVEVPSVIGVATRELAPGRARFTVDGREVALEPTVEEDGGLFFVFKDATAR
FT                   DATYGAGRFLSAEAPRDGKVVLDFNRAVNPPCAFSAFATCPLPTPENVLPVRIEAGEKR
FT                   YGEH"
     MPGNLAPLSF VLLTLVLAAC KSRPPADPAF AAEWKGWHDR REERLRMPTG WLALTGLHWL        60
     EPGENRIPGL PGTFTLEGGR VTLAAARSDG YVLGGAPLER RALAPDSAGE PDRVQLGASV       120
     TLAVIERSGR FAVRVWDAAA PARTGFRGID AYPPDPRWRI EARWEAYPAP REVEVPSVIG       180
     VATRELAPGR ARFTVDGREV ALEPTVEEDG GLFFVFKDAT ARDATYGAGR FLSAEAPRDG       240
     KVVLDFNRAV NPPCAFSAFA TCPLPTPENV LPVRIEAGEK RYGEH                       285
//

If you have problems or comments...

PBIL Back to PBIL home page