(data stored in ACNUC7421 zone)

EMBL: CP000251.PE95

CP000251.PE95        Location/Qualifiers
FT   CDS             115411..116538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Adeh_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Adeh_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABC79873"
FT                   /db_xref="UniProtKB/TrEMBL:Q2IM38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="ABC79873.1"
FT                   /translation="MAAARRILALPLALALAALPAQADGPAGGAAPAPSPEASPPEDAA
FT                   PRAPGPEVVRLRFAWPAPLDAQVTCRRTRVRTGAPPSVFTARYRQRAAAAGAGEAGLAI
FT                   STRGTTWEGDLPWAPAVARQALHASEQLVQRIGPDGAFAALEGAEALRPALRSLVDGAG
FT                   VQGAQAERAVARAEAGARGEAEELWNLSVGFWIDADLVLGQEYVMPSESELPLLPGVRG
FT                   PASVEFAVRRRVPCAAAERAARCVEIVLHATPEPAALARHAAALRARLAEGAEAPVPVP
FT                   AAHGRDGGELQAESTLVLVTDPATLVPRRVAWTRAVRLASAEDGAPALEHVDRVEYDYR
FT                   YPGKAPAAPPALRRRHAPGAPLEPAPVPAPVPVGI"
     MAAARRILAL PLALALAALP AQADGPAGGA APAPSPEASP PEDAAPRAPG PEVVRLRFAW        60
     PAPLDAQVTC RRTRVRTGAP PSVFTARYRQ RAAAAGAGEA GLAISTRGTT WEGDLPWAPA       120
     VARQALHASE QLVQRIGPDG AFAALEGAEA LRPALRSLVD GAGVQGAQAE RAVARAEAGA       180
     RGEAEELWNL SVGFWIDADL VLGQEYVMPS ESELPLLPGV RGPASVEFAV RRRVPCAAAE       240
     RAARCVEIVL HATPEPAALA RHAAALRARL AEGAEAPVPV PAAHGRDGGE LQAESTLVLV       300
     TDPATLVPRR VAWTRAVRLA SAEDGAPALE HVDRVEYDYR YPGKAPAAPP ALRRRHAPGA       360
     PLEPAPVPAP VPVGI                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page