(data stored in ACNUC7421 zone)

EMBL: CP000270.COXL1

CP000270.COXL1       Location/Qualifiers
FT   CDS             complement(131417..133798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL1"
FT                   /locus_tag="Bxe_A4352"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="Citation: Appl. Environ. Microbiol. 69 (12),7257-
FT                   7265 (2003)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28648"
FT                   /db_xref="GOA:Q146U1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U1"
FT                   /protein_id="ABE28648.1"
FT                   /translation="MNAPETHLIGASVERKEDYRFLTGNGQYTDDIVLPQQTYAVFLRS
FT                   PYAHAKINTIDTTAAKQSPGVVAIFTGADMAADNVGGLPCGWLIHSTDGKPMNEPPHPV
FT                   IAHTKVRHVGDQVALVIADSIKAAKDAAELIEVDYDVLPAVVDTAHAADAGQPAVHDEV
FT                   PDNVCYNWGHGDKAATDAAFAKAAHVTTLDIVNNRLIPNAIEPRAVNASYSAQDDSYTL
FT                   YVANQNPHVERLLMAAFVLSLPESKLRVIAPDVGGGFGSKIFLYAEDVALTWASKKIRR
FT                   PVKWTAERSEAFVSDAHGRDHVTKAELALDADGRFLAMRIHTTANMGAYLSTFASSVPT
FT                   ILYATLLAGQYATPAIYAEVKAVFTNTVPVDAYRGAGRPEATYVVERLVETAARELKLD
FT                   PAEIRRRNFIREFPYATPVGLTYDTGDYETILARSLELADVKGFAARRQESEKNGKLRG
FT                   LGYSCYIEACGLAPSNIAGALGARAGLFEVGQIRVHPTGSVTVFTGSHSHGQGHETTFA
FT                   QVVAERLGIALESVEIVHGDTGRIPFGMGTYGSRSIAVGGSAIMKALDKIETKAKKIAA
FT                   HLLEAAAEDIEFKDGVFRVAGTDRTKAFAEISLAAYVPHNYPLDVLEPGLEESAFYDPT
FT                   NFTYPSGAYICEIEVDPDTGVCRIQQFTAVDDFGNVINPMIVEGQVHGGLAQGIGQAML
FT                   ERCVYDNESGQLLSGSYMDYAMPHASDLPDFTVETAKGTPCTHNPLGVKGCGEAGAIGS
FT                   PPAVINAILDALAPLGVTDLQMPATPHRVWSAIHAAKQAH"
     MNAPETHLIG ASVERKEDYR FLTGNGQYTD DIVLPQQTYA VFLRSPYAHA KINTIDTTAA        60
     KQSPGVVAIF TGADMAADNV GGLPCGWLIH STDGKPMNEP PHPVIAHTKV RHVGDQVALV       120
     IADSIKAAKD AAELIEVDYD VLPAVVDTAH AADAGQPAVH DEVPDNVCYN WGHGDKAATD       180
     AAFAKAAHVT TLDIVNNRLI PNAIEPRAVN ASYSAQDDSY TLYVANQNPH VERLLMAAFV       240
     LSLPESKLRV IAPDVGGGFG SKIFLYAEDV ALTWASKKIR RPVKWTAERS EAFVSDAHGR       300
     DHVTKAELAL DADGRFLAMR IHTTANMGAY LSTFASSVPT ILYATLLAGQ YATPAIYAEV       360
     KAVFTNTVPV DAYRGAGRPE ATYVVERLVE TAARELKLDP AEIRRRNFIR EFPYATPVGL       420
     TYDTGDYETI LARSLELADV KGFAARRQES EKNGKLRGLG YSCYIEACGL APSNIAGALG       480
     ARAGLFEVGQ IRVHPTGSVT VFTGSHSHGQ GHETTFAQVV AERLGIALES VEIVHGDTGR       540
     IPFGMGTYGS RSIAVGGSAI MKALDKIETK AKKIAAHLLE AAAEDIEFKD GVFRVAGTDR       600
     TKAFAEISLA AYVPHNYPLD VLEPGLEESA FYDPTNFTYP SGAYICEIEV DPDTGVCRIQ       660
     QFTAVDDFGN VINPMIVEGQ VHGGLAQGIG QAMLERCVYD NESGQLLSGS YMDYAMPHAS       720
     DLPDFTVETA KGTPCTHNPL GVKGCGEAGA IGSPPAVINA ILDALAPLGV TDLQMPATPH       780
     RVWSAIHAAK QAH                                                          793
//

If you have problems or comments...

PBIL Back to PBIL home page