(data stored in ACNUC7421 zone)

EMBL: CP000270.PE107

CP000270.PE107       Location/Qualifiers
FT   CDS             complement(128198..129577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4355"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28645"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U4"
FT                   /protein_id="ABE28645.1"
FT                   /translation="MANSFDAGNGGASAQSARLDAGNSDASGDLSRADRPGRRVVASSS
FT                   SGKSAATPLDGTPTLARNVVHFVRLLRGAGLPMSPAQAVDALAALHWIDLGRRDDVRAA
FT                   LAASLVSAPDERDLFNAAFDLFWRDPDWEGKLRALLLPKVRDGLPPPKRNNRLADALAV
FT                   RAPPSAHNKAPQETGQHELHAHVTFSAEERLRHRDFDTLSADEWRTLRHLIRGQRLPLA
FT                   TEPTRRLKAASHGTHADLRASARHAVRAGGDWTVWKYRAVVERKPPLVLLLDISGSMSS
FT                   YSRAVLYFCHALLQSRERLQVFLFGTRLTNATRALRERDPDVAMAALTEQVVDWSGGTR
FT                   IGAALAEFNRRWARRVLTGRATVLLVTDGLDHEAIDVLDTEMARLHRFAHRIVWLNPLL
FT                   RFSGFSPKARGVQAILPYVDAHRPVHNLDSLTAFGRDLAQLTRAPRRSVGARAAGATSW
FT                   N"
     MANSFDAGNG GASAQSARLD AGNSDASGDL SRADRPGRRV VASSSSGKSA ATPLDGTPTL        60
     ARNVVHFVRL LRGAGLPMSP AQAVDALAAL HWIDLGRRDD VRAALAASLV SAPDERDLFN       120
     AAFDLFWRDP DWEGKLRALL LPKVRDGLPP PKRNNRLADA LAVRAPPSAH NKAPQETGQH       180
     ELHAHVTFSA EERLRHRDFD TLSADEWRTL RHLIRGQRLP LATEPTRRLK AASHGTHADL       240
     RASARHAVRA GGDWTVWKYR AVVERKPPLV LLLDISGSMS SYSRAVLYFC HALLQSRERL       300
     QVFLFGTRLT NATRALRERD PDVAMAALTE QVVDWSGGTR IGAALAEFNR RWARRVLTGR       360
     ATVLLVTDGL DHEAIDVLDT EMARLHRFAH RIVWLNPLLR FSGFSPKARG VQAILPYVDA       420
     HRPVHNLDSL TAFGRDLAQL TRAPRRSVGA RAAGATSWN                              459
//

If you have problems or comments...

PBIL Back to PBIL home page