(data stored in ACNUC7421 zone)

EMBL: CP000270.PE11

CP000270.PE11        Location/Qualifiers
FT   CDS             complement(15111..16586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4452"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28549"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E0"
FT                   /protein_id="ABE28549.1"
FT                   /translation="MSRTQEKHNRSVSKDVLVVGGGTSGFVAAIAAARNGASVLLLEQR
FT                   DHLGGTHSGGMVMMIRSMRHMKAPANMEQKKIMMTGYESSFDDEQVVRSIVQEYINRML
FT                   EIGSAWGRKDEATARQMFDPEIAKWVIQDMVAEAGVEVWLNTQATDVIMEGNALKGVVI
FT                   ESLRDRVEVHAGITIDTTGDGDIAAAAGAAFEFGSPEDGKCQPASLYFAVGGVQLDKTI
FT                   AYMRDHANEFGEEYVKTMVGLKEQNKPITMFPFKEKIREALKNGDYPIPYGVETVNPDT
FT                   LSYIVRPMFRNGKFRYDVTYHNMDMAYNFDATDRVELTKATLAMRDLANKMAKFYRKYV
FT                   PGYEDSYLSYTAQSVGIRDSRRIVCDYTLTREDVLAGQVFPDGIGRYGSLMDVHDKSGK
FT                   KSLSLVEVGGHGWFHVPFRSLLPKGIENLMVAGRCISADYDAQGSVRSQAASMVTGQAT
FT                   GTAAALAVQQKRKLRELDVSALQEVLKAQNQVI"
     MSRTQEKHNR SVSKDVLVVG GGTSGFVAAI AAARNGASVL LLEQRDHLGG THSGGMVMMI        60
     RSMRHMKAPA NMEQKKIMMT GYESSFDDEQ VVRSIVQEYI NRMLEIGSAW GRKDEATARQ       120
     MFDPEIAKWV IQDMVAEAGV EVWLNTQATD VIMEGNALKG VVIESLRDRV EVHAGITIDT       180
     TGDGDIAAAA GAAFEFGSPE DGKCQPASLY FAVGGVQLDK TIAYMRDHAN EFGEEYVKTM       240
     VGLKEQNKPI TMFPFKEKIR EALKNGDYPI PYGVETVNPD TLSYIVRPMF RNGKFRYDVT       300
     YHNMDMAYNF DATDRVELTK ATLAMRDLAN KMAKFYRKYV PGYEDSYLSY TAQSVGIRDS       360
     RRIVCDYTLT REDVLAGQVF PDGIGRYGSL MDVHDKSGKK SLSLVEVGGH GWFHVPFRSL       420
     LPKGIENLMV AGRCISADYD AQGSVRSQAA SMVTGQATGT AAALAVQQKR KLRELDVSAL       480
     QEVLKAQNQV I                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page