(data stored in ACNUC7421 zone)

EMBL: CP000270.PE114

CP000270.PE114       Location/Qualifiers
FT   CDS             complement(138005..139396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4348"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28652"
FT                   /db_xref="GOA:Q146T7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T7"
FT                   /protein_id="ABE28652.1"
FT                   /translation="MSLFRKKSVEHMIAASAQNAGLKKALGALDLTFLGVGAIIGTGIF
FT                   VLTGTGAVQAGPALMISFLIAALACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAW
FT                   IIGWDLMLEYGLATSAVSVGWSGYLQSLLSGFGVSLPVALTAAPGALPGHDTLFNLPAF
FT                   LVMMAITALLSFGVRESARINNIMVAIKVIVVLLVICVGVFHVTPANWHPFMPNGWNGV
FT                   FGAAAVMFFAFIGFDSVSSAAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPS
FT                   AQFANISHPVSYALQVAGQKWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLP
FT                   ARLSRVHPRFATPFFTTWLVGIFFGLIGAVVPLNVLAELINIGTLAAFSMVSIAVLVLR
FT                   KTHPELPRAFRCPGVPVVPVLAVASCLFLMINLQAVTWVAFVVWLLVGMVVYFGYSRRH
FT                   SRLSS"
     MSLFRKKSVE HMIAASAQNA GLKKALGALD LTFLGVGAII GTGIFVLTGT GAVQAGPALM        60
     ISFLIAALAC GFAALAYAEF ASTIPVAGSI YTYSYATLGE LAAWIIGWDL MLEYGLATSA       120
     VSVGWSGYLQ SLLSGFGVSL PVALTAAPGA LPGHDTLFNL PAFLVMMAIT ALLSFGVRES       180
     ARINNIMVAI KVIVVLLVIC VGVFHVTPAN WHPFMPNGWN GVFGAAAVMF FAFIGFDSVS       240
     SAAEEVKNPK RDLPIGIIAS LGVCAVLYVA VAAVVTGIVP SAQFANISHP VSYALQVAGQ       300
     KWVAGFIDLG AVLGMLTVIL VMAYGQTRVI FAMSRDGLLP ARLSRVHPRF ATPFFTTWLV       360
     GIFFGLIGAV VPLNVLAELI NIGTLAAFSM VSIAVLVLRK THPELPRAFR CPGVPVVPVL       420
     AVASCLFLMI NLQAVTWVAF VVWLLVGMVV YFGYSRRHSR LSS                         463
//

If you have problems or comments...

PBIL Back to PBIL home page