(data stored in ACNUC7421 zone)

EMBL: CP000270.PE120

CP000270.PE120       Location/Qualifiers
FT   CDS             complement(144125..145096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4342"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28658"
FT                   /db_xref="GOA:Q146T1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T1"
FT                   /protein_id="ABE28658.1"
FT                   /translation="MTAAPRATAATTVRKWRHLAMQREVIVLLAMVLFNLFFTPHFWSL
FT                   QTFNVNMTQVVTIVIVGIGMTLVVATGGIDLSVGASMAISGALAPMLFLNIAGPGGIAL
FT                   AFVLPVLAAALCGVFNGLLVTRLSVQPIVATLVLFIAGRGIAQVVTDGSLQAFNTPAFQ
FT                   WIALGKVAGVPFQVLLMLALVALFVWVVRKTLFGQYLLITGGNEKAAYLCGVPTATVKL
FT                   IAYTLCAALAGLAGLISISVNSSSDANVVGLGVELDAIAAVAVGGTALTGGKAYIGGTL
FT                   IGALIIQLLRYTLLAHGIPDAAALVVKAGIIVAAVYVQRRSR"
     MTAAPRATAA TTVRKWRHLA MQREVIVLLA MVLFNLFFTP HFWSLQTFNV NMTQVVTIVI        60
     VGIGMTLVVA TGGIDLSVGA SMAISGALAP MLFLNIAGPG GIALAFVLPV LAAALCGVFN       120
     GLLVTRLSVQ PIVATLVLFI AGRGIAQVVT DGSLQAFNTP AFQWIALGKV AGVPFQVLLM       180
     LALVALFVWV VRKTLFGQYL LITGGNEKAA YLCGVPTATV KLIAYTLCAA LAGLAGLISI       240
     SVNSSSDANV VGLGVELDAI AAVAVGGTAL TGGKAYIGGT LIGALIIQLL RYTLLAHGIP       300
     DAAALVVKAG IIVAAVYVQR RSR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page