(data stored in ACNUC7421 zone)

EMBL: CP000270.PE124

CP000270.PE124       Location/Qualifiers
FT   CDS             149750..150682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4338"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28662"
FT                   /db_xref="GOA:Q146S7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S7"
FT                   /protein_id="ABE28662.1"
FT                   /translation="MWLDDPAIVATVVTLSAGAQRVVIAPEVGGALAAFYETTPDGPLH
FT                   WLRPAAPAAFAERDPLRMASFPLLPYCNRIRDARFEFDGGTIDLAGNDARFAHALHGNA
FT                   WRHPWQVGARTESSVELHFEHEPDSRLRGDWPFRYRAQQRIELSGGALHITLSAQNLAA
FT                   RPMPFGMGHHPYYPRTAQTRVYAEVGAMWHADADVLPTHLGPHPAVAALREGMSADAFD
FT                   LDNNFANWSREATIAWPDEHRRLTMIADAPFDHMVVFAPANEAQLCVEPVTNTTDCFNA
FT                   VGMREQVGGCVLQPGEKIAATVKWTPHKN"
     MWLDDPAIVA TVVTLSAGAQ RVVIAPEVGG ALAAFYETTP DGPLHWLRPA APAAFAERDP        60
     LRMASFPLLP YCNRIRDARF EFDGGTIDLA GNDARFAHAL HGNAWRHPWQ VGARTESSVE       120
     LHFEHEPDSR LRGDWPFRYR AQQRIELSGG ALHITLSAQN LAARPMPFGM GHHPYYPRTA       180
     QTRVYAEVGA MWHADADVLP THLGPHPAVA ALREGMSADA FDLDNNFANW SREATIAWPD       240
     EHRRLTMIAD APFDHMVVFA PANEAQLCVE PVTNTTDCFN AVGMREQVGG CVLQPGEKIA       300
     ATVKWTPHKN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page