(data stored in ACNUC7421 zone)

EMBL: CP000270.PE126

CP000270.PE126       Location/Qualifiers
FT   CDS             complement(151611..152147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4336"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28664"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S5"
FT                   /protein_id="ABE28664.1"
FT                   /translation="MWKTSIVAVLLGTSLLANAQQSAQGTQQNTPPRPAQQVVQWQLQV
FT                   MRDGQQIDAFDGTTTVGQARTDTHHKIVQHNVGCKDQPGGSIDLARTLTVSPLLADASG
FT                   VTLSIEAQETFEEDAARQTDTGCKLPPQPRQVSASHPGLKVAPGQWASWTIVDKDPNLV
FT                   YRVRASLADSANTAN"
     MWKTSIVAVL LGTSLLANAQ QSAQGTQQNT PPRPAQQVVQ WQLQVMRDGQ QIDAFDGTTT        60
     VGQARTDTHH KIVQHNVGCK DQPGGSIDLA RTLTVSPLLA DASGVTLSIE AQETFEEDAA       120
     RQTDTGCKLP PQPRQVSASH PGLKVAPGQW ASWTIVDKDP NLVYRVRASL ADSANTAN         178
//

If you have problems or comments...

PBIL Back to PBIL home page