(data stored in ACNUC7421 zone)

EMBL: CP000270.PE133

CP000270.PE133       Location/Qualifiers
FT   CDS             159653..159898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28671"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R8"
FT                   /protein_id="ABE28671.1"
FT                   /translation="MTRARLREVGLNECPRPGYLKRGGQFAIKRNALQSGSKRRKSRKT
FT                   IETFSIIHFSGAEHLGTVQRIGSPVRRAHWRKRNPS"
     MTRARLREVG LNECPRPGYL KRGGQFAIKR NALQSGSKRR KSRKTIETFS IIHFSGAEHL        60
     GTVQRIGSPV RRAHWRKRNP S                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page