(data stored in ACNUC7421 zone)

EMBL: CP000270.PE144

CP000270.PE144       Location/Qualifiers
FT   CDS             complement(172139..172768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4318"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28682"
FT                   /db_xref="GOA:Q146Q7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q7"
FT                   /protein_id="ABE28682.1"
FT                   /translation="MSSEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKRLIATFSANL
FT                   ELLEGARPHPVQEAWWKTQPEAWEACRKDLQTPVAALTAYVDWVEALPGKPVFVAMPAG
FT                   FDFTYMFWYMMRFVGRCPFSWSALDIKTLAFAMTGLPYRKNIKPRFPKHWFDEHPHTHV
FT                   ALDDAIEQGALFCNMLKDLRASQAITLAAGKDGDGTGQNPAEKPAN"
     MSSEIYVSTD VEADGPIPGP HSMLSFASAA YTEDKRLIAT FSANLELLEG ARPHPVQEAW        60
     WKTQPEAWEA CRKDLQTPVA ALTAYVDWVE ALPGKPVFVA MPAGFDFTYM FWYMMRFVGR       120
     CPFSWSALDI KTLAFAMTGL PYRKNIKPRF PKHWFDEHPH THVALDDAIE QGALFCNMLK       180
     DLRASQAITL AAGKDGDGTG QNPAEKPAN                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page