(data stored in ACNUC7421 zone)

EMBL: CP000270.PE145

CP000270.PE145       Location/Qualifiers
FT   CDS             complement(172765..173409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4317"
FT                   /product="Putative metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28683"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q6"
FT                   /protein_id="ABE28683.1"
FT                   /translation="MKVTLIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDVIQGEIARQ
FT                   NVSVEKVFLTHGHIDHCAGAKTLASRYDVPIEGPHPDERFWLDKLPDQSTRFGFPAAEA
FT                   FEPDRWLQNGETVQFGDEILEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDF
FT                   PRGNHADLVRSIREKLWPLGDDVTFVPGHGPTSTFGAERRTNPYVCDGVEA"
     MKVTLIPVTP FQQNSSLLVC EATGRAAVVD PGGDLDVIQG EIARQNVSVE KVFLTHGHID        60
     HCAGAKTLAS RYDVPIEGPH PDERFWLDKL PDQSTRFGFP AAEAFEPDRW LQNGETVQFG       120
     DEILEVYHCP GHTPGHVVFF SRAHRLALVG DVLFAGSIGR TDFPRGNHAD LVRSIREKLW       180
     PLGDDVTFVP GHGPTSTFGA ERRTNPYVCD GVEA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page