(data stored in ACNUC7421 zone)

EMBL: CP000270.PE146

CP000270.PE146       Location/Qualifiers
FT   CDS             173522..173803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28684"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q5"
FT                   /protein_id="ABE28684.1"
FT                   /translation="MKIHQGFQSLVIPKFCFGYNGLHAQGTVLPQGDASPSKMGTRIAT
FT                   QVWAVALMDGHQVSMHSMHTSCPARRHAPATELNTVTLGGAYAAVPAR"
     MKIHQGFQSL VIPKFCFGYN GLHAQGTVLP QGDASPSKMG TRIATQVWAV ALMDGHQVSM        60
     HSMHTSCPAR RHAPATELNT VTLGGAYAAV PAR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page