(data stored in ACNUC7421 zone)

EMBL: CP000270.PE148

CP000270.PE148       Location/Qualifiers
FT   CDS             complement(174762..175640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4314"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28686"
FT                   /db_xref="GOA:Q146Q3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q3"
FT                   /protein_id="ABE28686.1"
FT                   /translation="MTPLSELAQGQQYPTAALYVVATPIGNIADVTLRALHVLGLVDRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHQHNERAAALRLIEHLQAGERVAYVSDAGTPGISD
FT                   PGAKLVDAVREAGFPVIPLPGASALATALSAAGDWVATFSFLGFLPPKAKARAATLQSL
FT                   ANHPHAMVFYEAPHRIVETVQALAEAFGGERKLLIARELTKLHEALHRGTLAEGPAWLA
FT                   ADPNRQRGEFVLVVEGAQPETAGEHDHDALLGILLEELTVSSAAKVAAAITGASRNALY
FT                   TRALALKKDEE"
     MTPLSELAQG QQYPTAALYV VATPIGNIAD VTLRALHVLG LVDRIAAEDT RNTGQLLARY        60
     GISKPLVAVH QHNERAAALR LIEHLQAGER VAYVSDAGTP GISDPGAKLV DAVREAGFPV       120
     IPLPGASALA TALSAAGDWV ATFSFLGFLP PKAKARAATL QSLANHPHAM VFYEAPHRIV       180
     ETVQALAEAF GGERKLLIAR ELTKLHEALH RGTLAEGPAW LAADPNRQRG EFVLVVEGAQ       240
     PETAGEHDHD ALLGILLEEL TVSSAAKVAA AITGASRNAL YTRALALKKD EE               292
//

If you have problems or comments...

PBIL Back to PBIL home page