(data stored in ACNUC7421 zone)

EMBL: CP000270.PE149

CP000270.PE149       Location/Qualifiers
FT   CDS             175729..176151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4313"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28687"
FT                   /db_xref="GOA:Q146Q2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Q2"
FT                   /protein_id="ABE28687.1"
FT                   /translation="MRAVAPIGAFATPDNFSAPVGSKLVGAAFEARAQEFLQRQRLRFV
FT                   ARNVACRGGEIDLVMRERDGALVFVEVRARAQRRYGGAAASIGWRKQQRIVRAAQHYLA
FT                   TRSSQLRDQPACRFDVIAFEAGRLVWLRDAFRADEV"
     MRAVAPIGAF ATPDNFSAPV GSKLVGAAFE ARAQEFLQRQ RLRFVARNVA CRGGEIDLVM        60
     RERDGALVFV EVRARAQRRY GGAAASIGWR KQQRIVRAAQ HYLATRSSQL RDQPACRFDV       120
     IAFEAGRLVW LRDAFRADEV                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page