(data stored in ACNUC7421 zone)

EMBL: CP000270.PE156

CP000270.PE156       Location/Qualifiers
FT   CDS             complement(182537..182836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28694"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P5"
FT                   /protein_id="ABE28694.1"
FT                   /translation="MRAAEAAGRGLEFWGMRICYGGFPGCGGKPNSLLARVEAVTSALI
FT                   RETLPEERQTIVCDDLLAHVVWMAFDGFVINHRIGDLRDMDAIAELMVKLLFGE"
     MRAAEAAGRG LEFWGMRICY GGFPGCGGKP NSLLARVEAV TSALIRETLP EERQTIVCDD        60
     LLAHVVWMAF DGFVINHRIG DLRDMDAIAE LMVKLLFGE                               99
//

If you have problems or comments...

PBIL Back to PBIL home page