(data stored in ACNUC7421 zone)

EMBL: CP000270.PE164

CP000270.PE164       Location/Qualifiers
FT   CDS             191016..192584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4297"
FT                   /product="Putative diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28702"
FT                   /db_xref="GOA:Q146N7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N7"
FT                   /protein_id="ABE28702.1"
FT                   /translation="MPERQVMVTRRPNIVIAISIVLASAILAIAVWVLAQMRDDALRRA
FT                   QDSVFNVSLLVERDVSRNLEIYDLSLRAVLDGLKQPGVLDLKPAMRQMVLFDGSASAKD
FT                   MGSILVTDEAGNVRFDSQATPPRQVNLADRDYFKVQRDSPNAGLFISHPFIPKVGGKDV
FT                   SIALSRRITRPDGGFGGVVAGTMRLTYFHSLFAGMNLGVGGSMALMLSDGTMLMRRPYD
FT                   PKMIGINLTGTANYSRFTEQPSGDFFGTAALDGVERWYAFRHIDMYPLILDVALSTRDI
FT                   YAQWRHRAWIIGSLIAALDVTIIALAVLFSQQLRHRRAAEEELRVLACTDGLTGLFNRR
FT                   TYEQQAEGEWRRAQRNARPLSMLLIDVDNFKGFNDLYGHSAGDEALIGVARCISQSVRR
FT                   PGDTAARYGGEEFAVLLPDTDEAGATRIAGKICAAVEALQLRHVASSHCVLTVSIGVAT
FT                   TRGQAFATSRALVDAADEALYEAKDAGRNCVLCFGATTHATHAMHATLGTTSVAGTGTK
FT                   KLLRN"
     MPERQVMVTR RPNIVIAISI VLASAILAIA VWVLAQMRDD ALRRAQDSVF NVSLLVERDV        60
     SRNLEIYDLS LRAVLDGLKQ PGVLDLKPAM RQMVLFDGSA SAKDMGSILV TDEAGNVRFD       120
     SQATPPRQVN LADRDYFKVQ RDSPNAGLFI SHPFIPKVGG KDVSIALSRR ITRPDGGFGG       180
     VVAGTMRLTY FHSLFAGMNL GVGGSMALML SDGTMLMRRP YDPKMIGINL TGTANYSRFT       240
     EQPSGDFFGT AALDGVERWY AFRHIDMYPL ILDVALSTRD IYAQWRHRAW IIGSLIAALD       300
     VTIIALAVLF SQQLRHRRAA EEELRVLACT DGLTGLFNRR TYEQQAEGEW RRAQRNARPL       360
     SMLLIDVDNF KGFNDLYGHS AGDEALIGVA RCISQSVRRP GDTAARYGGE EFAVLLPDTD       420
     EAGATRIAGK ICAAVEALQL RHVASSHCVL TVSIGVATTR GQAFATSRAL VDAADEALYE       480
     AKDAGRNCVL CFGATTHATH AMHATLGTTS VAGTGTKKLL RN                          522
//

If you have problems or comments...

PBIL Back to PBIL home page