(data stored in ACNUC7421 zone)

EMBL: CP000270.PE175

CP000270.PE175       Location/Qualifiers
FT   CDS             complement(205552..206469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4286"
FT                   /product="Putative carbohydrate kinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28713"
FT                   /db_xref="GOA:Q146M6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M6"
FT                   /protein_id="ABE28713.1"
FT                   /translation="MSNPGVNSEFPLFVSAGDILTDLVRTGPSQWLSRPGGAGWNVARC
FT                   VARLGLPTACAGSLGVDNFSDELWNASVAAGLDMRFMQRVERPPLLAIVHQTHPPAYFF
FT                   MGENGADLAFDPARLPAGWASHVKWAHFGCISLVRQPLGNTLAALAAQLRSQGVKISFD
FT                   PNYRNLMEHGYEPTLRKMAALADLIKVSDEDLRLLFKTDDEASALAQLRAMNPAATVLV
FT                   TRGPETAVLIDGAVVTEARPPRVEVVDTVGAGDASIGGLLFSLMTAPQRAWPEHLAFAL
FT                   AAGAAACRHAGAHAPSLDEVVALL"
     MSNPGVNSEF PLFVSAGDIL TDLVRTGPSQ WLSRPGGAGW NVARCVARLG LPTACAGSLG        60
     VDNFSDELWN ASVAAGLDMR FMQRVERPPL LAIVHQTHPP AYFFMGENGA DLAFDPARLP       120
     AGWASHVKWA HFGCISLVRQ PLGNTLAALA AQLRSQGVKI SFDPNYRNLM EHGYEPTLRK       180
     MAALADLIKV SDEDLRLLFK TDDEASALAQ LRAMNPAATV LVTRGPETAV LIDGAVVTEA       240
     RPPRVEVVDT VGAGDASIGG LLFSLMTAPQ RAWPEHLAFA LAAGAAACRH AGAHAPSLDE       300
     VVALL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page