(data stored in ACNUC7421 zone)

EMBL: CP000270.PE181

CP000270.PE181       Location/Qualifiers
FT   CDS             212747..213202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4280"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28719"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M0"
FT                   /protein_id="ABE28719.1"
FT                   /translation="MPHGGSGGYAHAPTNHAVRGNLHHGGSYNGATAGPAHTTMADRDA
FT                   HLPRGGVNGAGGNYGNGFGIYNPGMRRVAAPAGYAGDGRGGMQYAGAITPVSAESRAVP
FT                   RPPVNAPVRAGSIRADVARYNEERGATRAMQRQADDPRQPEGSPYRN"
     MPHGGSGGYA HAPTNHAVRG NLHHGGSYNG ATAGPAHTTM ADRDAHLPRG GVNGAGGNYG        60
     NGFGIYNPGM RRVAAPAGYA GDGRGGMQYA GAITPVSAES RAVPRPPVNA PVRAGSIRAD       120
     VARYNEERGA TRAMQRQADD PRQPEGSPYR N                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page