(data stored in ACNUC7421 zone)

EMBL: CP000270.PE188

CP000270.PE188       Location/Qualifiers
FT   CDS             complement(223424..223903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4273"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28726"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L3"
FT                   /protein_id="ABE28726.1"
FT                   /translation="MNAAPRIVTIGETFSSTLELSAESVKSFASLVNDHNPLHHDEAYA
FT                   AQSRFGGLIASGTQPTAHFMALLATHFSTYAQPLGLEFDIKLKKAVRANDTLTITWRVK
FT                   DAYWKPSLNGDLTQLEGTVVNQRGDTMLTGSSTILVMPKSEAAANTHANAAPNSP"
     MNAAPRIVTI GETFSSTLEL SAESVKSFAS LVNDHNPLHH DEAYAAQSRF GGLIASGTQP        60
     TAHFMALLAT HFSTYAQPLG LEFDIKLKKA VRANDTLTIT WRVKDAYWKP SLNGDLTQLE       120
     GTVVNQRGDT MLTGSSTILV MPKSEAAANT HANAAPNSP                              159
//

If you have problems or comments...

PBIL Back to PBIL home page