(data stored in ACNUC7421 zone)

EMBL: CP000270.PE190

CP000270.PE190       Location/Qualifiers
FT   CDS             complement(224150..224671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4271"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28728"
FT                   /db_xref="GOA:Q146L1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L1"
FT                   /protein_id="ABE28728.1"
FT                   /translation="MTDHASPETDDLTALPDSARRVALLLRERGHAGRIVMLPETGKTS
FT                   AEAAAGLGCSVAQIAKSILFRRREDDAPVLVVASGANRVDEKKVAAQVGEIGRADAKFV
FT                   REKTGYAIGGVCPIGHATEPVTLIDADLLELDSLWAAAGHPHAVFNLTAQELIALTGAP
FT                   VVDVALRETA"
     MTDHASPETD DLTALPDSAR RVALLLRERG HAGRIVMLPE TGKTSAEAAA GLGCSVAQIA        60
     KSILFRRRED DAPVLVVASG ANRVDEKKVA AQVGEIGRAD AKFVREKTGY AIGGVCPIGH       120
     ATEPVTLIDA DLLELDSLWA AAGHPHAVFN LTAQELIALT GAPVVDVALR ETA              173
//

If you have problems or comments...

PBIL Back to PBIL home page